PDA

View Full Version : one cool domain name...



mlk
July 5th, 2004, 07:07 PM
I challenge anyone to find a longer and weirder (sp?) domain name:

http://14159265358979323846264338327950288419716939937510 5820974944592.com/

Jeff Wheeler
July 5th, 2004, 07:16 PM
that's impressive, but http://www.llanfairpwllgwyngyllgogerychwyrndrobwyll-llantysiliogogogoch.com/ beats it

bodyvisual
July 5th, 2004, 07:43 PM
**** how do they remember what it is?!

:)

Jeff Wheeler
July 5th, 2004, 07:59 PM
if you lived in that city don't you think you could remember your claim to fame? probably not :P

Total Biscuit
July 6th, 2004, 04:34 AM
a while back there was a page with the domain www.[insert 60 "1"s here].com
yes 60 times the number 1!

paradox244
July 6th, 2004, 08:16 AM
The first one is pi out to the 63 digit, thats easy enough to remember...

El_Thierro
July 6th, 2004, 08:43 AM
What a waste of money lol :D

mlk
July 6th, 2004, 09:26 AM
that's impressive, but http://www.llanfairpwllgwyngyllgoge...iogogogoch.com/ beats it

nope if you add the www in http://1415926535897932384626433832...0974944592.com/ which I omitted, you still end up with 3 more characters....

Jeff Wheeler
July 6th, 2004, 06:08 PM
ugh! blast, I'll try to do better, there are about ten cities in that network, did you see any others?

hificopymaster
July 6th, 2004, 06:11 PM
http://www.thepersonwithanewideaisacrank-untiltheideasucceeds-by-marktwain.com/
and
http://www.thelongestdomainnameintheworldandthensomeandth ensomemoreandmore.com/

Yay for Google.

[EDIT] Haha, and some guy has: http://www.iwantedthelongestdomainnameintheworldandthisis aprettygoodone.com/ with the email address: iwantedthelongestemailaddressintheworldandithinkif oundit@iwantedthelongestdomainnameintheworldandthi sisaprettygoodone.com

Jeff Wheeler
July 6th, 2004, 06:26 PM
wow, I think you beat us all

mjULTRA
July 6th, 2004, 07:12 PM
www . johnkerryisadouchebagbutimvotingforhimanyway . com

http://www.johnkerryisadouchebagbutimvotingforhimanyway.c om/

(44 letters)

**Majeye does not condone voting for Republicrats or Demopublicans...**

hificopymaster
July 6th, 2004, 07:23 PM
wow, I think you beat us all :pleased:

Disco-Stu
July 7th, 2004, 05:00 AM
www.antidisestablishmentarianism.com

longest non-medical word in the english dictionary (even though it is almost a double negative, it is recognized)

Jeff Wheeler
July 7th, 2004, 01:49 PM
that's not true, the whales city I posted is longer...

tucker
July 7th, 2004, 02:04 PM
but its a city not a word ;D

Jeff Wheeler
July 7th, 2004, 02:05 PM
cities can be word's, like dallas is a word, just not in the dictionary

thoriphes
July 7th, 2004, 02:09 PM
this isn't a domain name, but it's a pretty long city name:


Krungthepmahanakornamornratanakosinmahintarayuttha yamahadilokphopnopparatrajathaniburiromudomrajaniw esmahasatharnamornphimarnavatarnsathitsakkattiyavi sanukamprasit

in New Zealand.

Jeff Wheeler
July 7th, 2004, 02:12 PM
hmm... it's a city but not one word, I don't know...

thoriphes
July 7th, 2004, 02:21 PM
no, it is one word, I don't know why the forum is interpreting it that way. If i try to take away the spaces, letters start disappearing.

I guess the word is just too long ;)

Jeff Wheeler
July 7th, 2004, 02:22 PM
lol, ok, in that case you've got me beat, again :(

JRPereira
July 8th, 2004, 04:08 PM
this isn't a domain name, but it's a pretty long city name:


Krungthepmahanakornamornratanakosinmahintarayuttha yamahadilokphopnopparatrajathaniburiromudomrajaniw esmahasatharnamornphimarnavatarnsathitsakkattiyavi sanukamprasit

in New Zealand.

uh, how do you suppose that's pronounced? I don't suppose you can just say "i want to go to krung" and be on your way.

Krilnon
July 8th, 2004, 04:14 PM
And here I was thinking that was actually PHP code...

Yeldarb
July 8th, 2004, 05:23 PM
I'd say it's pronounced something like this:
http://hegel.research.att.com/tts/speech/6902a67b34000482564e5bad45356e97.wav

Link will go down in 5 minutes though :(

thoriphes
July 8th, 2004, 05:44 PM
Correction:

That ridiculously long name I posted is not in New Zealand, but actually in Thailand.

hl
December 4th, 2004, 12:03 AM
THAILAND. "Bangkok is a city of extremes and superlatives, a city you do not react to indifferently," says Thailand at a Glance. "Recently declared the world's hottest city by the World Meteorological Organization, it also boasts the world's longest name:

Krung-thep-maha-nakorn-boworn-ratana-kosin-mahintar- ayudhya-amaha-dilok-pop-nopa-ratana-rajthani-burirom-udom-rajniwes-mahasat-arn-amorn-pimarn- avatar-satit- sakattiya-visanukam.

"Not surprisingly, only a handful of Thais can remember such a mouthful, although the abbreviated translation of the whole is a relatively brief Jewelled city of the god Indra. However, most Thais simply refer to it as Krung Thep, City Angels."

We sought a ruling from a Bangkok wordsmith, Theppitak Karoonboonyanan who said the correct spelling (163 letters) is

Krungthepmahanakornamornratanakosinmahintarayuttha yamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit .

Theppitak separated the words of K161t and translated them as:

krungthep mahanakorn
The great city of angels,

amorn rattanakosin mahintara yutthaya mahadilok phop
the supreme unconqueralble land of the great immortal divinity (Indra),

noparat rajathani burirom
the royal capital of nine noble gems, the pleasant city,

udomrajaniwes mahasatharn
with plenty of grand royal palaces,

amorn phimarn avatarnsathit
and divine paradises for the reincarnated deity (Vishnu),

sakkatattiya visanukam prasit
given by Indra and created by the god of crafting (Visnukarma).

"It's a kind of honoring or celebrating in (royal) Thai culture to name long (I couldn't confirm this in terms of historical background, though)," Theppitak said. "King Rama 1, the founder of the city himself, was named yet longer than the name of the city, in his ascending to the throne. Our King Rama 9 (King Bhumipol) also has a long name of a hundred letters.

"The name of the city was given by King Rama 1, the founder of the city, to celebrate the new capital, 219 years ago, after Sukhothai, Ayudhaya, and Thonburi. He moved the capital of the country from Thonburi to a place called Bangkok at that time, and named the new capital as rungthepmahanakhorn. The name has been changed a little by King Rama 4 (King Mongkut) which has been used until now.

"The name Bangkok is still used in international context because it was more familiar to foreigners in the past. In Thai, the city is called Krungthep in short, and is written with an abbreviation sign after it.

"It may be pronounced as Krungthepmahanakorn in some formal occasions. But when we refer to the full name, it's the one with hundreds letters as mentioned. If you want to get some formal evidence of the name, you may have to ask some governmental offices, or the Royal Palace.The old name Bangkok is only used in foreign languages, or it becomes informal in Thai."



pronounciation inside

http://www.thailandlife.com/ericshackle/placename.html

prit
December 4th, 2004, 11:32 AM
**** how do they remember what it is?!

:)that city means something in Welsh, so I'm sure its not that hard to remember if you speak Welsh

Jako
December 5th, 2004, 08:05 PM
What is the limit for a domain name, or does it all depend on the registar?

hl
December 5th, 2004, 08:19 PM
i think the limit is 60 not including the .ext

zacus
December 6th, 2004, 08:43 AM
is it just me or is this to random to not be in Randommmmmm

??